LRIT3 Peptide - middle region
LRIT3 Peptide - middle region
Product Specifications
UniProt
Q3SXY7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRIT3 Rabbit Polyclonal Antibody (orb327022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P4073-34K 200 µL
PIK3CD, phosphorylated (Tyr524) (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit delta Isoform, PtdIns-3-kinase Subunit delta, PI3-kinase Subunit delta, PI3K-delta, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit delta, PI3-kinase p110 Subunit delta, PtdIns-3-kinase subunit p110-delta)
Sign In for Pricing
View Details