Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP5L Peptide - C-terminal region

LRP5L Peptide - C-terminal region

Product Specifications

UniProt

A4QPB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRP5L Rabbit Polyclonal Antibody (orb587518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adprm Mouse Gene Knockout Kit (CRISPR)
KN500926 1 Kit

Adprm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNF alpha (TNF656), CF740 conjugate, 0.1mg/mL
BNC740656-100 1x 100 µL

TNF alpha (TNF656), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]
TA813980BM 100 µL

CD47 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]

Sign In for Pricing
View Details
Human ARRDC3 activation kit by CRISPRa
GA111590 1 Kit

Human ARRDC3 activation kit by CRISPRa

Sign In for Pricing
View Details
Iodine
TRC-I666750-5G 5 g

Iodine

Sign In for Pricing
View Details
Human EFTUD1 (EFL1) activation kit by CRISPRa
GA112503 1 Kit

Human EFTUD1 (EFL1) activation kit by CRISPRa

Sign In for Pricing
View Details