Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP5L Peptide - C-terminal region

LRP5L Peptide - C-terminal region

Product Specifications

UniProt

A4QPB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRP5L Rabbit Polyclonal Antibody (orb587518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B4]
TA504176BM 100 µL

NMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: transverse
CB538642 1 Block

Frozen Tissue Blocks, Colon: transverse

Sign In for Pricing
View Details
CLCN4 (NM_001830) Human Over-expression Lysate
LY419731 100 µg

CLCN4 (NM_001830) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 2-'Ethoxy-'1-'((2'-'(5-'oxo-'2,'5-'dihydro-'1,'2,'4-'oxadiazol-'3-'yl)'-'[1,'1'-'biphenyl]'-'4
TRC-E678645-250MG 250 mg

Ethyl 2-'Ethoxy-'1-'((2'-'(5-'oxo-'2,'5-'dihydro-'1,'2,'4-'oxadiazol-'3-'yl)'-'[1,'1'-'biphenyl]'-'4

Sign In for Pricing
View Details
Rnf150 Mouse Gene Knockout Kit (CRISPR)
KN514914 1 Kit

Rnf150 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Activin A Receptor Type IB (ACVR1B) Human Gene Knockout Kit (CRISPR)
KN206920RB 1 Kit

Activin A Receptor Type IB (ACVR1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details