LRRC37A2 Peptide - C-terminal region
LRRC37A2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LRRC37
UniProt
A6NM11
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRC37A2 Rabbit Polyclonal Antibody (orb55735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001006608.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RESQDGLSSFGQPLWFKDLYKPLSATRINNHAWKLHKKSSNEDKILNRDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2104369-01 5x 96 Tests
Human RCC1 And BTB Domain Containing Protein 2 (RCBTB2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2104369-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Human RCC1 And BTB Domain Containing Protein 2 (RCBTB2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2104369-03 10x 96 Tests
Human RCC1 And BTB Domain Containing Protein 2 (RCBTB2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2104369-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Human RCC1 And BTB Domain Containing Protein 2 (RCBTB2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details