Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC37A2 Peptide - C-terminal region

LRRC37A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC37

UniProt

A6NM11

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC37A2 Rabbit Polyclonal Antibody (orb55735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006608.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RESQDGLSSFGQPLWFKDLYKPLSATRINNHAWKLHKKSSNEDKILNRDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Choline/ethanolaminephosphotransferase 1 (CEPT1) ELISA Kit
GTR10349395 96 Well

Rat Choline/ethanolaminephosphotransferase 1 (CEPT1) ELISA Kit

Sign In for Pricing
View Details
Ethyl 5,5-dimethyl-4-oxooxolane-3-carboxylate
DXC60860-01 50 mg

Ethyl 5,5-dimethyl-4-oxooxolane-3-carboxylate

Sign In for Pricing
View Details
Ethyl 5,5-dimethyl-4-oxooxolane-3-carboxylate
DXC60860-02 0.5 g

Ethyl 5,5-dimethyl-4-oxooxolane-3-carboxylate

Sign In for Pricing
View Details
L-Histidine (base) extrapure CHR, 99%
94495-01 25 g

L-Histidine (base) extrapure CHR, 99%

Sign In for Pricing
View Details
L-Histidine (base) extrapure CHR, 99%
94495-02 100 g

L-Histidine (base) extrapure CHR, 99%

Sign In for Pricing
View Details
L-Histidine (base) extrapure CHR, 99%
94495-03 500 g

L-Histidine (base) extrapure CHR, 99%

Sign In for Pricing
View Details