Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL30 Peptide - C-terminal region

MRPL30 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L28MT, L30MT, MRP-L28, MRP-L30, MRPL28, MRPL28M, RPML28

UniProt

Q8TCC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL30 Rabbit Polyclonal Antibody (orb587540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660213

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC691921 (NM_001135566) Rat Tagged ORF Clone
RR206020 10 µg

LOC691921 (NM_001135566) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human Granzyme B HEK293 Overexpression Lysate
MBS8113744-01 0.3 mg

Human Granzyme B HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human Granzyme B HEK293 Overexpression Lysate
MBS8113744-02 5x 0.3 mg

Human Granzyme B HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Xininurad
BA7069-1 1 mg

Xininurad

Sign In for Pricing
View Details
3BP1 Polyclonal Antibody
E11-201304 100 µg -100 µL

3BP1 Polyclonal Antibody

Sign In for Pricing
View Details
SPAG8 (NM_001039592) Human Tagged ORF Clone
RG219119 10 µg

SPAG8 (NM_001039592) Human Tagged ORF Clone

Sign In for Pricing
View Details