Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL30 Peptide - C-terminal region

MRPL30 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L28MT, L30MT, MRP-L28, MRP-L30, MRPL28, MRPL28M, RPML28

UniProt

Q8TCC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL30 Rabbit Polyclonal Antibody (orb587540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660213

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm3409 Recombinant Protein (Mouse)
RP137873 100 µg

Gm3409 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SSX3 Antibody - middle region : FITC (ARP51078_P050-FITC)
ARP51078_P050-FITC 100 µL

SSX3 Antibody - middle region : FITC (ARP51078_P050-FITC)

Sign In for Pricing
View Details
m-Anisidine, 4-((3-ethylheptyl)oxy)-, hydrochloride
MBS5782739 Inquire

m-Anisidine, 4-((3-ethylheptyl)oxy)-, hydrochloride

Sign In for Pricing
View Details
TOP2A Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61077R-PerCP-Cy5.5 100 µL

TOP2A Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Thrombomodulin Recombinant Rabbit mAb, capture
E47P0012C 100 µL

Thrombomodulin Recombinant Rabbit mAb, capture

Sign In for Pricing
View Details
Kcnk4 (NM_008431) Mouse Tagged Lenti ORF Clone
MR221486L3 10 µg

Kcnk4 (NM_008431) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details