MRPS36 Peptide - middle region
MRPS36 Peptide - middle region
Product Specifications
Product Name Alternative
MRP-S36
UniProt
P82909
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS36 Rabbit Polyclonal Antibody (orb587548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_150597
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP47818_P050-HRP 100 µL
Thg1l Antibody - N-terminal region : HRP (ARP47818_P050-HRP)
Sign In for Pricing
View Details H6098-40T-ML490 100 µL
HLA Class 1 Antigen B, NT (HLA Cass I Histocompatibility Antigen B-27 alpha Chain, HLA B Class I, HLA-B, HLAB, HLA-B27, HLA-B73, AS, MGC111087, MHC Class I Antigen B*27, SPDA1) (MaxLight 490) discontinued
Sign In for Pricing
View Details ![3',4'-dimethoxy-[1,1'-biphenyl]-4-carboxylic acid](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
