Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS36 Peptide - middle region

MRPS36 Peptide - middle region

Product Specifications

Product Name Alternative

MRP-S36

UniProt

P82909

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS36 Rabbit Polyclonal Antibody (orb587548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150597

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM106B siRNA (Human)
MBS8220178-01 15 nmol

TMEM106B siRNA (Human)

Sign In for Pricing
View Details
TMEM106B siRNA (Human)
MBS8220178-02 30 nmol

TMEM106B siRNA (Human)

Sign In for Pricing
View Details
TMEM106B siRNA (Human)
MBS8220178-03 5x 30 nmol

TMEM106B siRNA (Human)

Sign In for Pricing
View Details
Rat Nuclear factor-kappa B (NF-κB) ELISA Kit
201-11-0288 96 Tests

Rat Nuclear factor-kappa B (NF-κB) ELISA Kit

Sign In for Pricing
View Details
Recombinant Trichophyton verrucosum Probable leucine aminopeptidase 2 (LAP2)
MBS1247463-01 0.02 mg (E-Coli)

Recombinant Trichophyton verrucosum Probable leucine aminopeptidase 2 (LAP2)

Sign In for Pricing
View Details
Recombinant Trichophyton verrucosum Probable leucine aminopeptidase 2 (LAP2)
MBS1247463-02 0.02 mg (Yeast)

Recombinant Trichophyton verrucosum Probable leucine aminopeptidase 2 (LAP2)

Sign In for Pricing
View Details