Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS36 Peptide - N-terminal region

MRPS36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-S36

UniProt

P82909

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS36 Rabbit Polyclonal Antibody (orb587549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150597

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS702731 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) Human Knockdown Lysate
LY300277 100 µg

Peroxiredoxin 5 (PRDX5) Human Knockdown Lysate

Sign In for Pricing
View Details
Recombinant Tbp7 Antibody
RC-16605-01 50 μL

Recombinant Tbp7 Antibody

Sign In for Pricing
View Details
Recombinant Tbp7 Antibody
RC-16605-02 100 µL

Recombinant Tbp7 Antibody

Sign In for Pricing
View Details
Recombinant Tbp7 Antibody
RC-16605-03 1 mL

Recombinant Tbp7 Antibody

Sign In for Pricing
View Details
Mouse Ccng2 activation kit by CRISPRa
GA200586 1 Kit

Mouse Ccng2 activation kit by CRISPRa

Sign In for Pricing
View Details