Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS36 Peptide - N-terminal region

MRPS36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-S36

UniProt

P82909

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS36 Rabbit Polyclonal Antibody (orb587549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150597

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG-beta (hCGb/459), CF488A conjugate, 0.1mg/mL
BNC880211-100 1x 100 µL

HCG-beta (hCGb/459), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPM4 (NM_001145160) Human Recombinant Protein
TP327534L 1 mg

TPM4 (NM_001145160) Human Recombinant Protein

Sign In for Pricing
View Details
Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate
TRC-S743925-10MG 10 mg

Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate

Sign In for Pricing
View Details
Mouse Frg1 activation kit by CRISPRa
GA201474 1 Kit

Mouse Frg1 activation kit by CRISPRa

Sign In for Pricing
View Details
CCN2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B12]
TA806838BM 100 µL

CCN2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B12]

Sign In for Pricing
View Details
6-Perdeoxy-6-perchloro-Gamma-cyclodextrin, >90%
TRC-P999728-50MG 50 mg

6-Perdeoxy-6-perchloro-Gamma-cyclodextrin, >90%

Sign In for Pricing
View Details