NBPF15 Peptide - N-terminal region
NBPF15 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AG3, AB14, NBPF16
UniProt
Q5SXJ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NBPF15 Rabbit Polyclonal Antibody (orb587563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001164226.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQKLSPENDNDDDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-500 1x 500 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041952-500 1x 500 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940470-500 1x 500 µL
CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details