Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARC Peptide - C-terminal region

ARC Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arg3.1

UniProt

Q7LC44

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARC Rabbit Polyclonal Antibody (orb576995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056008

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
MBS406740-01 1 g

H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
MBS406740-02 5 g

H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
MBS406740-03 5x 5 g

H-Asn(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB

Sign In for Pricing
View Details
O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride
orb1985505-01 100 mg

O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride

Sign In for Pricing
View Details
O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride
orb1985505-02 25 mg

O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride

Sign In for Pricing
View Details
O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride
orb1985505-03 50 mg

O-Toluidine, 4,4'-pentamethylenedioxydi-, dihydrochloride

Sign In for Pricing
View Details