Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARC Peptide - C-terminal region

ARC Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arg3.1

UniProt

Q7LC44

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARC Rabbit Polyclonal Antibody (orb576995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056008

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Kir5.1 (pS416) Antibody
MBS4513742-01 0.05 mL

Rabbit anti-Kir5.1 (pS416) Antibody

Sign In for Pricing
View Details
Rabbit anti-Kir5.1 (pS416) Antibody
MBS4513742-02 0.1 mL

Rabbit anti-Kir5.1 (pS416) Antibody

Sign In for Pricing
View Details
Rabbit anti-Kir5.1 (pS416) Antibody
MBS4513742-03 5x 0.1 mL

Rabbit anti-Kir5.1 (pS416) Antibody

Sign In for Pricing
View Details
Rabbit Apolipoprotein L3 (APOL3) ELISA Kit
GTR10323505 96 Well

Rabbit Apolipoprotein L3 (APOL3) ELISA Kit

Sign In for Pricing
View Details
Gm9758 Mouse qPCR Template Standard (NM_198666)
MK204311 1 Kit

Gm9758 Mouse qPCR Template Standard (NM_198666)

Sign In for Pricing
View Details
LRRC25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA504902BM 100 µL

LRRC25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details