Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBNA1BP2 Peptide - middle region

EBNA1BP2 Peptide - middle region

Product Specifications

UniProt

H7C2Q8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EBNA1BP2 Rabbit Polyclonal Antibody (orb586071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153408

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIA4 Polyclonal Antibody
E-AB-52766-01 20 µL

PDIA4 Polyclonal Antibody

Sign In for Pricing
View Details
PDIA4 Polyclonal Antibody
E-AB-52766-02 60 µL

PDIA4 Polyclonal Antibody

Sign In for Pricing
View Details
PDIA4 Polyclonal Antibody
E-AB-52766-03 120 µL

PDIA4 Polyclonal Antibody

Sign In for Pricing
View Details
PDIA4 Polyclonal Antibody
E-AB-52766-04 200 µL

PDIA4 Polyclonal Antibody

Sign In for Pricing
View Details
gamma Tubulin (TUBG1) Human Knockdown Lysate
LY300313 100 µg

gamma Tubulin (TUBG1) Human Knockdown Lysate

Sign In for Pricing
View Details
CD73 (NT5E) Mouse Monoclonal Antibody [Clone ID: AD2]
AM26144PU-N 100 µg

CD73 (NT5E) Mouse Monoclonal Antibody [Clone ID: AD2]

Sign In for Pricing
View Details