EBNA1BP2 Peptide - middle region
EBNA1BP2 Peptide - middle region
Product Specifications
UniProt
H7C2Q8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EBNA1BP2 Rabbit Polyclonal Antibody (orb586071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001153408
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CLACHE100-4 1000 Tests
Bioluminescent Acetylcholinesterase Assay Kit
Sign In for Pricing
View Details 
BNC741594-100 1x 100 µL
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 