Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN2 Peptide - N-terminal region

RIN2 Peptide - N-terminal region

Product Specifications

UniProt

E7EPJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIN2 Rabbit Polyclonal Antibody (orb326582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCARDSGYDSLSNRLSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPS6KA6 Protein, GST Tag
E40KMPH1262 20 µg

Human RPS6KA6 Protein, GST Tag

Sign In for Pricing
View Details
DAG1 Antibody (C-term)
MBS9205082-01 0.08 mL

DAG1 Antibody (C-term)

Sign In for Pricing
View Details
DAG1 Antibody (C-term)
MBS9205082-02 0.4 mL

DAG1 Antibody (C-term)

Sign In for Pricing
View Details
DAG1 Antibody (C-term)
MBS9205082-03 5x 0.4 mL

DAG1 Antibody (C-term)

Sign In for Pricing
View Details
Ethyl 2-cyclopropyl-4-oxo-1,4-dihydropyrimidine-5-carboxylate hydrochloride
XWC94927 2.5 g

Ethyl 2-cyclopropyl-4-oxo-1,4-dihydropyrimidine-5-carboxylate hydrochloride

Sign In for Pricing
View Details
Gm1332 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
21821154 3x 1.0 µg DNA

Gm1332 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details