Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN2 Peptide - N-terminal region

RIN2 Peptide - N-terminal region

Product Specifications

UniProt

E7EPJ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIN2 Rabbit Polyclonal Antibody (orb326582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCARDSGYDSLSNRLSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem107 3'UTR GFP Stable Cell Line
TU170616 1.0 mL

Tmem107 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GATA3 Mouse Monoclonal Antibody [Clone ID: OTI4D5]
CF809143 100 µg

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI4D5]

Sign In for Pricing
View Details
Granzyme M Blocking Peptide
CBP3983-01 1 mg

Granzyme M Blocking Peptide

Sign In for Pricing
View Details
Granzyme M Blocking Peptide
CBP3983-02 5 mg

Granzyme M Blocking Peptide

Sign In for Pricing
View Details
HTA9 HTA11 Rabbit pAb
A20568 200 µL

HTA9 HTA11 Rabbit pAb

Sign In for Pricing
View Details
Hsa-miR-105-3p miRNA Inhibitor
orb1873008-01 10 nmol

Hsa-miR-105-3p miRNA Inhibitor

Sign In for Pricing
View Details