Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC80 Peptide - C-terminal region

CCDC80 Peptide - C-terminal region

Product Specifications

UniProt

E7ENF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC80 Rabbit Polyclonal Antibody (orb586467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD3 Protein Vector (Human) (pPB-His-MBP)
PV318838 500 ng

ABCD3 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Rabbit Polyclonal ARF6 Antibody [Alexa Fluor 350]
NBP2-41263AF350 0.1 mL

Rabbit Polyclonal ARF6 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Human DSPG3 (NP_004941.2) VersaClone cDNA
RDC3293 10 µg

Human DSPG3 (NP_004941.2) VersaClone cDNA

Sign In for Pricing
View Details
Lentiviral mouse Invs shRNA (UAS) - Lentiviral mouse Invs shRNA (UAS, RFP) (100)
GTR15242856 1 Vial

Lentiviral mouse Invs shRNA (UAS) - Lentiviral mouse Invs shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ZBED4 Rabbit Polyclonal Antibody (Biotin)
orb449273 100 µL

ZBED4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Doxorubicinol Hydrochloride (Mixture of diastereomers)
163964 2 mg

Doxorubicinol Hydrochloride (Mixture of diastereomers)

Sign In for Pricing
View Details