Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC80 Peptide - C-terminal region

CCDC80 Peptide - C-terminal region

Product Specifications

UniProt

E7ENF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC80 Rabbit Polyclonal Antibody (orb586467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CYP2D6 Protein, N-His
orb3154983-01 50 µg

Recombinant Human CYP2D6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CYP2D6 Protein, N-His
orb3154983-02 100 µg

Recombinant Human CYP2D6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CYP2D6 Protein, N-His
orb3154983-03 1 mg

Recombinant Human CYP2D6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Matrix Gla Protein
MBS144956-01 0.005 mg

Recombinant Human Matrix Gla Protein

Sign In for Pricing
View Details
Recombinant Human Matrix Gla Protein
MBS144956-02 0.02 mg

Recombinant Human Matrix Gla Protein

Sign In for Pricing
View Details
Recombinant Human Matrix Gla Protein
MBS144956-03 1 mg

Recombinant Human Matrix Gla Protein

Sign In for Pricing
View Details