Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTSL1 Peptide - N-terminal region

ADAMTSL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADAMTSL-1, ADAMTSR1, C9orf94, PUNCTIN

UniProt

Q8N6G6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAMTSL1 Rabbit Polyclonal Antibody (orb586523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443098

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL
BNC040738-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details