Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPAP1 Peptide - N-terminal region

RPAP1 Peptide - N-terminal region

Product Specifications

UniProt

Q9BWH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPAP1 Rabbit Polyclonal Antibody (orb586642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Ovary: right
CP565769 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
MMP-9 Recombinant Rabbit monoclonal Antibody
HA751070 100 µL

MMP-9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Batf3 Mouse Gene Knockout Kit (CRISPR)
KN501985 1 Kit

Batf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FKBP2 (NM_001135208) Human Over-expression Lysate
LY427591 100 µg

FKBP2 (NM_001135208) Human Over-expression Lysate

Sign In for Pricing
View Details
PML Protein (PML) Rabbit Polyclonal Antibody
TA363698 100 µL

PML Protein (PML) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Formylcytosine
TRC-F698975-5MG 5 mg

5-Formylcytosine

Sign In for Pricing
View Details