Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPAP1 Peptide - N-terminal region

RPAP1 Peptide - N-terminal region

Product Specifications

UniProt

Q9BWH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPAP1 Rabbit Polyclonal Antibody (orb586642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)
PDMH100336-01 20 µg

Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)
PDMH100336-02 100 µg

Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)
PDMH100336-03 500 µg

Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)
PDMH100336-04 1 mg

Recombinant Human GITR/TNFRSF18 Protein (Fc Tag)

Sign In for Pricing
View Details
Human ASXL1 activation kit by CRISPRa
GA116235 1 Kit

Human ASXL1 activation kit by CRISPRa

Sign In for Pricing
View Details
HIS Lite™ Cy5 Tris NTA Chelator
12659-AAT 100 µg

HIS Lite™ Cy5 Tris NTA Chelator

Sign In for Pricing
View Details