Ndufaf5 Peptide - middle region
Ndufaf5 Peptide - middle region
Product Specifications
UniProt
A2APY7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ndufaf5 Rabbit Polyclonal Antibody (orb586664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTMLAAAAVYREMYRNEDGSIPATFQIYHMI GWKYHDSQARPAERGSAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041234-100 1x 100 µL
Bcl-2 (100/D5 + 124), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H949030-5MG 5 mg
(5Beta,6Alpha)-6-Hydroxy-3-oxo-cholan-24-oic Acid
Sign In for Pricing
View Details 
