Ndufaf5 Peptide - middle region
Ndufaf5 Peptide - middle region
Product Specifications
UniProt
A2APY7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ndufaf5 Rabbit Polyclonal Antibody (orb586664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTMLAAAAVYREMYRNEDGSIPATFQIYHMI GWKYHDSQARPAERGSAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942982-500 1x 500 µL
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741805-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 