Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL1 Peptide - N-terminal region

CDKL1 Peptide - N-terminal region

Product Specifications

UniProt

J3KMW1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL1 Rabbit Polyclonal Antibody (orb586783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DP) (beta chain) (BRA-FB6), CF640R conjugate, 0.1mg/mL
BNC400199-500 1x 500 µL

MHC II (HLA-DP) (beta chain) (BRA-FB6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenylate cyclase 1 Rabbit Polyclonal Antibody (PerCP)
orb2427875 100 µL

Adenylate cyclase 1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Nck beta Rabbit Polyclonal Antibody (HRP)
orb468728 100 µL

Nck beta Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PAI1 Rabbit mAb
56181 50 µL

PAI1 Rabbit mAb

Sign In for Pricing
View Details
Goat anti-Pig Albumin Antibody Affinity Purified
MBS3900097-01 1 mg

Goat anti-Pig Albumin Antibody Affinity Purified

Sign In for Pricing
View Details
Goat anti-Pig Albumin Antibody Affinity Purified
MBS3900097-02 5x 1 mg

Goat anti-Pig Albumin Antibody Affinity Purified

Sign In for Pricing
View Details