Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL1 Peptide - N-terminal region

CDKL1 Peptide - N-terminal region

Product Specifications

UniProt

J3KMW1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL1 Rabbit Polyclonal Antibody (orb586783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD123 (HI12H7)
FITC-30052-01 50 Tests

FITC Anti-Human CD123 (HI12H7)

Sign In for Pricing
View Details
FITC Anti-Human CD123 (HI12H7)
FITC-30052-02 100 Tests

FITC Anti-Human CD123 (HI12H7)

Sign In for Pricing
View Details
Lentiviral human GGA3 shRNA (UAS) - Lentiviral human GGA3 shRNA (UAS, iRFP) plasmid
GTR15323275 1 Vial

Lentiviral human GGA3 shRNA (UAS) - Lentiviral human GGA3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EEED8.10 Antibody
orb803369 2 mg

EEED8.10 Antibody

Sign In for Pricing
View Details
DAG1 Polyclonal Antibody
E11-200019 100 µg -100 µL

DAG1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RP105/CD180 Antibody [HRP]
NBP1-76707H 0.1 mL

Rabbit Polyclonal RP105/CD180 Antibody [HRP]

Sign In for Pricing
View Details