NUGGC Peptide - C-terminal region
NUGGC Peptide - C-terminal region
Product Specifications
Product Name Alternative
C8orf80, SLIP-GC
UniProt
Q68CJ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUGGC Rabbit Polyclonal Antibody (orb326930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010906
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![STAT5B Rabbit Monoclonal Antibody [Clone ID: R01-6A3]](https://cdn.genprice.uk/products/937/6868c2cf994c49e6dc3e79f7/imageurl/ta385339.webp)
TA385339 100 µL
STAT5B Rabbit Monoclonal Antibody [Clone ID: R01-6A3]
Sign In for Pricing
View Details 
