NUGGC Peptide - C-terminal region
NUGGC Peptide - C-terminal region
Product Specifications
Product Name Alternative
C8orf80, SLIP-GC
UniProt
Q68CJ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUGGC Rabbit Polyclonal Antibody (orb326930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010906
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APC Anti-Rat CD4 (domain 1) Antibody[OX-38]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2905/imageurl/e-ab-f1105e.webp)
E-AB-F1105E-01 50 Tests
APC Anti-Rat CD4 (domain 1) Antibody[OX-38]
Sign In for Pricing
View Details E-AB-F1105E-02 100 Tests
APC Anti-Rat CD4 (domain 1) Antibody[OX-38]
Sign In for Pricing
View Details E-AB-F1105E-03 2x 100 Tests
APC Anti-Rat CD4 (domain 1) Antibody[OX-38]
Sign In for Pricing
View Details ![FABP3 Recombinant Rabbit Monoclonal Antibody [JE53-37]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80f94/imageurl/ha721859.webp)
HA721859 100 µL
FABP3 Recombinant Rabbit Monoclonal Antibody [JE53-37]
Sign In for Pricing
View Details 
LY431447 100 µg
Calcitonin receptor (CALCR) (NM_001164737) Human Over-expression Lysate
Sign In for Pricing
View Details