Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBF4B Peptide - N-terminal region

DBF4B Peptide - N-terminal region

Product Specifications

UniProt

Q8NFT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBF4B Rabbit Polyclonal Antibody (orb587354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR 1078
TRC-S683900-5MG 5 mg

SR 1078

Sign In for Pricing
View Details
Mouse Spef1 activation kit by CRISPRa
GA208693 1 Kit

Mouse Spef1 activation kit by CRISPRa

Sign In for Pricing
View Details
HER2 / ErbB2 Recombinant Rabbit monoclonal Antibody
IRS034 100 µL

HER2 / ErbB2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-01 50 μL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-02 100 µL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-03 1 mL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details