Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBF4B Peptide - N-terminal region

DBF4B Peptide - N-terminal region

Product Specifications

UniProt

Q8NFT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBF4B Rabbit Polyclonal Antibody (orb587354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor™ 594 Conjugated GFAP Mouse Monoclonal Antibody [1-D4]
HA600102F 100 µL

iFluor™ 594 Conjugated GFAP Mouse Monoclonal Antibody [1-D4]

Sign In for Pricing
View Details
MTF1 (MTF1/2649), CF405S conjugate, 0.1mg/mL
BNC042649-100 1x 100 µL

MTF1 (MTF1/2649), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Nitroquinoline N-Oxide
TRC-N900715-5G 5 g

4-Nitroquinoline N-Oxide

Sign In for Pricing
View Details
Dipyrrolidinylthiuram Disulfide-D16
TRC-D263054-10MG 10 mg

Dipyrrolidinylthiuram Disulfide-D16

Sign In for Pricing
View Details
Purified Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097A-01 25 µg

Purified Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Purified Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097A-02 100 µg

Purified Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details