Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR176 Peptide - C-terminal region

GPR176 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR, Gm1012

UniProt

Q14439

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR176 Rabbit Polyclonal Antibody (orb587440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009154

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC067068 AAV Vector (Mouse) (CMV)
13181104 1 µg

BC067068 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
CDK5RAP2 Antibody, FITC conjugated
MBS7053135-01 0.05 mg

CDK5RAP2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CDK5RAP2 Antibody, FITC conjugated
MBS7053135-02 0.1 mg

CDK5RAP2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CDK5RAP2 Antibody, FITC conjugated
MBS7053135-03 5x 0.1 mg

CDK5RAP2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PNLDC1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37094124 3x 1.0µg DNA

PNLDC1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
HEXA (Beta-N-acetylhexosaminidase subunit alpha)
144657 100 µg

HEXA (Beta-N-acetylhexosaminidase subunit alpha)

Sign In for Pricing
View Details