Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR176 Peptide - C-terminal region

GPR176 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR, Gm1012

UniProt

Q14439

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR176 Rabbit Polyclonal Antibody (orb587440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009154

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human CLPS polyclonal antibody
CABT-B268-01 100 ul

Rabbit Anti-Human CLPS polyclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CLPS polyclonal antibody
CABT-B268-02 100 µg

Rabbit Anti-Human CLPS polyclonal antibody

Sign In for Pricing
View Details
OR1J1 Conjugated Antibody
C44992 100 µL

OR1J1 Conjugated Antibody

Sign In for Pricing
View Details
PRSS16 Antibody
GWB-MP095E 50 µg

PRSS16 Antibody

Sign In for Pricing
View Details
Cinnamyl caffeate
MBS5762076 Inquire

Cinnamyl caffeate

Sign In for Pricing
View Details
Human CYP3A4 (Cytochrome P450 3A4) ELISA Kit
EH0777 96 Tests

Human CYP3A4 (Cytochrome P450 3A4) ELISA Kit

Sign In for Pricing
View Details