Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD11B1L Peptide - C-terminal region

HSD11B1L Peptide - C-terminal region

Product Specifications

UniProt

Q7Z5J1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD11B1L Rabbit Polyclonal Antibody (orb587455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (OV-TL12/30), CF740 conjugate, 0.1mg/mL
BNC740683-100 1x 100 µL

Cytokeratin 7 (OV-TL12/30), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SYPL1 Antibody
RC-4804-01 50 μL

Recombinant SYPL1 Antibody

Sign In for Pricing
View Details
Recombinant SYPL1 Antibody
RC-4804-02 100 µL

Recombinant SYPL1 Antibody

Sign In for Pricing
View Details
Recombinant SYPL1 Antibody
RC-4804-03 1 mL

Recombinant SYPL1 Antibody

Sign In for Pricing
View Details
Isopropyl 4-Bromobutanoate
TRC-I570485-500MG 500 mg

Isopropyl 4-Bromobutanoate

Sign In for Pricing
View Details
SAM68 Recombinant Rabbit Monoclonal Antibody [JE47-15]
ET7109-52 100 µL

SAM68 Recombinant Rabbit Monoclonal Antibody [JE47-15]

Sign In for Pricing
View Details