Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIRMA Peptide - C-terminal region

VIRMA Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSTP054, fSAP121, KIAA1429

UniProt

Q69YN4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VIRMA Rabbit Polyclonal Antibody (orb587488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_892121

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORAI2 (NM_001126340) Human Over-expression Lysate
LC426680 20 µg

ORAI2 (NM_001126340) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH
HA710146 100 µg

Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
L-Rhamnose Diethyl Dithioacetal
TRC-R315050-50G 50 g

L-Rhamnose Diethyl Dithioacetal

Sign In for Pricing
View Details
GPR88 Human Gene Knockout Kit (CRISPR)
KN418133 1 Kit

GPR88 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC16A8 Human Gene Knockout Kit (CRISPR)
KN416789 1 Kit

SLC16A8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human USH2A activation kit by CRISPRa
GA105097 1 Kit

Human USH2A activation kit by CRISPRa

Sign In for Pricing
View Details