VIRMA Peptide - C-terminal region
VIRMA Peptide - C-terminal region
Product Specifications
Product Name Alternative
MSTP054, fSAP121, KIAA1429
UniProt
Q69YN4
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VIRMA Rabbit Polyclonal Antibody (orb587488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_892121
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400100-500 1x 500 µL
CMV-p65 (CMV100), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
