LRRC38 Peptide - C-terminal region
LRRC38 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RP4-597A16.1
UniProt
Q5VT99
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRC38 Rabbit Polyclonal Antibody (orb587522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010847
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6309621-01 0.2 mL
IHH, NT (IHH, Indian hedgehog protein, HHG-2, Indian hedgehog protein N-product, Indian hedgehog protein C-product) (FITC)
Sign In for Pricing
View Details MBS6309621-02 5x 0.2 mL
IHH, NT (IHH, Indian hedgehog protein, HHG-2, Indian hedgehog protein N-product, Indian hedgehog protein C-product) (FITC)
Sign In for Pricing
View Details 
H00084775-P01-10ug 10 µg
Recombinant Human ZNF607 Protein - (Dry Ice)
Sign In for Pricing
View Details 