Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC38 Peptide - C-terminal region

LRRC38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP4-597A16.1

UniProt

Q5VT99

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC38 Rabbit Polyclonal Antibody (orb587522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010847

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX43 Lentiviral Activation Particles (m2)
sc-437224-LAC-2 200 µL

DDX43 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Bovine Serpin Family F Member 2 (SERPINF2) ELISA Kit-Sandwich
EK11F422-01 48 Test

Bovine Serpin Family F Member 2 (SERPINF2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Serpin Family F Member 2 (SERPINF2) ELISA Kit-Sandwich
EK11F422-02 96 Tests

Bovine Serpin Family F Member 2 (SERPINF2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS800963 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Wnt5a/b Rabbit mAb
C05298-01 20 µL

Wnt5a/b Rabbit mAb

Sign In for Pricing
View Details
Wnt5a/b Rabbit mAb
C05298-02 100 µL

Wnt5a/b Rabbit mAb

Sign In for Pricing
View Details