Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEB5 Peptide - N-terminal region

MAGEB5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT3.3, MAGE-B5

UniProt

Q9BZ81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEB5 Rabbit Polyclonal Antibody (orb587527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258681

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubxn11 Mouse qPCR Primer Pair (NM_026257)
MP217982 200 Reactions

Ubxn11 Mouse qPCR Primer Pair (NM_026257)

Sign In for Pricing
View Details
Serine protease HTRA1
AP79255-01 50 µg

Serine protease HTRA1

Sign In for Pricing
View Details
Serine protease HTRA1
AP79255-02 100 µg

Serine protease HTRA1

Sign In for Pricing
View Details
Serine protease HTRA1
AP79255-03 1 mg

Serine protease HTRA1

Sign In for Pricing
View Details
AF/LE Purified Anti-Human IFN-γ Antibody
RD22146F-01 50 µg

AF/LE Purified Anti-Human IFN-γ Antibody

Sign In for Pricing
View Details
AF/LE Purified Anti-Human IFN-γ Antibody
RD22146F-02 500 µg

AF/LE Purified Anti-Human IFN-γ Antibody

Sign In for Pricing
View Details