Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEB5 Peptide - N-terminal region

MAGEB5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT3.3, MAGE-B5

UniProt

Q9BZ81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEB5 Rabbit Polyclonal Antibody (orb587527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258681

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal eIF4E Antibody [Janelia Fluor 549]
NBP2-98867JF549 0.1 mL

Rabbit Polyclonal eIF4E Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-FRS2 Antibody (R2J29)
RHJ29101 100 μg

Anti-FRS2 Antibody (R2J29)

Sign In for Pricing
View Details
HDEL Antibody
abx441178 100 µg

HDEL Antibody

Sign In for Pricing
View Details
HSP70 Antibody
MBS8582290-01 0.1 mL

HSP70 Antibody

Sign In for Pricing
View Details
HSP70 Antibody
MBS8582290-02 0.1 mL (AF635)

HSP70 Antibody

Sign In for Pricing
View Details
HSP70 Antibody
MBS8582290-03 0.1 mL (AF610)

HSP70 Antibody

Sign In for Pricing
View Details