Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBLAC1 Peptide - C-terminal region

MBLAC1 Peptide - C-terminal region

Product Specifications

UniProt

A4D2B0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBLAC1 Rabbit Polyclonal Antibody (orb327025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_981942

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAS2 Human qPCR Primer Pair (NM_012250)
HP229164 200 Reactions

RRAS2 Human qPCR Primer Pair (NM_012250)

Sign In for Pricing
View Details
Triisopropylsilanol
TRC-T219868-250MG 250 mg

Triisopropylsilanol

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7253-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), Biotin conjugate, 0.1mg/mL
BNCB1828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details