MBLAC1 Peptide - C-terminal region
MBLAC1 Peptide - C-terminal region
Product Specifications
UniProt
A4D2B0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MBLAC1 Rabbit Polyclonal Antibody (orb327025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_981942
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-G837910-50MG 50 mg
Guanosine-5'-triphosphate Trisodium Salt (Technical Grade)
Sign In for Pricing
View Details 
BNC742303-500 1x 500 µL
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881824-100 1x 100 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-A608859-100MG 100 mg
N-(2-Aminoethyl-1,1,2,2-d4)-5-chloroisoquinoline-8-sulfonamide Dihydrochloride
Sign In for Pricing
View Details