Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCMBP Peptide - N-terminal region

MCMBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf119, MCM-BP

UniProt

Q9BTE3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCMBP Rabbit Polyclonal Antibody (orb327026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079110

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein
TP321065M 100 µg

Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) Rabbit Monoclonal Antibody
TA423205 100 µL

GCSF Receptor (CSF3R) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]
AM20322PU-T 20 µg

CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]

Sign In for Pricing
View Details
NF-κB p65 (Ab-468) Antibody
8B7170-AAT 50 µg

NF-κB p65 (Ab-468) Antibody

Sign In for Pricing
View Details
KIF3C Antibody
KC-46243-01 50 μL

KIF3C Antibody

Sign In for Pricing
View Details
KIF3C Antibody
KC-46243-02 100 µL

KIF3C Antibody

Sign In for Pricing
View Details