METTL21C Peptide - N-terminal region
METTL21C Peptide - N-terminal region
Product Specifications
Product Name Alternative
C13orf39
UniProt
Q5VZV1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL21C Rabbit Polyclonal Antibody (orb327029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001010977
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471803-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401829-100 1x 100 µL
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470047-500 1x 500 µL
Plasma Cell Marker (LIV3G11, same as 7B18), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401219-500 1x 500 µL
Cytokeratin 8 (B22.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details