Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS5 Peptide - N-terminal region

MRPS5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-S5, S5mt

UniProt

P82675

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS5 Rabbit Polyclonal Antibody (orb587542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amino Magnetic Particles, 2.5% w/v, 4.0-4.9 µm
AM-40-10 10 mL

Amino Magnetic Particles, 2.5% w/v, 4.0-4.9 µm

Sign In for Pricing
View Details
NVP-QAV-572 100mg
A16273-100 100 mg

NVP-QAV-572 100mg

Sign In for Pricing
View Details
DBNDD2 Antibody
abx301648-01 20 µg

DBNDD2 Antibody

Sign In for Pricing
View Details
DBNDD2 Antibody
abx301648-02 50 µg

DBNDD2 Antibody

Sign In for Pricing
View Details
DBNDD2 Antibody
abx301648-03 100 µg

DBNDD2 Antibody

Sign In for Pricing
View Details
DBNDD2 Antibody
abx301648-04 200 µg

DBNDD2 Antibody

Sign In for Pricing
View Details