MRPS5 Peptide - N-terminal region
MRPS5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MRP-S5, S5mt
UniProt
P82675
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS5 Rabbit Polyclonal Antibody (orb587542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114108
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR205156L3 10 µg
Arhgef16 (NM_001127591) Rat Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
MBS6305859-01 0.2 mL
HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)
Sign In for Pricing
View Details MBS6305859-02 5x 0.2 mL
HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)
Sign In for Pricing
View Details K2478007 1.0 µg DNA
TRNAC13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details MBS6364555-01 0.2 mL
ZBTB12, CT (ZBTB12, C6orf46, G10, NG35, Zinc finger and BTB domain-containing protein 12, Protein G10) (PE)
Sign In for Pricing
View Details MBS6364555-02 5x 0.2 mL
ZBTB12, CT (ZBTB12, C6orf46, G10, NG35, Zinc finger and BTB domain-containing protein 12, Protein G10) (PE)
Sign In for Pricing
View Details