Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N4BP3 Peptide - N-terminal region

N4BP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LZTS4

UniProt

O15049

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with N4BP3 Rabbit Polyclonal Antibody (orb587556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055926

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Skin
CS623798 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Octahydroindoline-2-carboxylic Acid Benzyl Ester (-)-Dibenzoyl-L-tartaric Acid
TRC-O236505-250MG 250 mg

Octahydroindoline-2-carboxylic Acid Benzyl Ester (-)-Dibenzoyl-L-tartaric Acid

Sign In for Pricing
View Details
Microcirculation Microscope BMIC-103
BMIC-103 1 Unit

Microcirculation Microscope BMIC-103

Sign In for Pricing
View Details
TIM 3 Recombinant Chimeric Antibody Antibody
HA601442 100 µL

TIM 3 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
OR2M3 Antibody
8G561-AAT 50 µg

OR2M3 Antibody

Sign In for Pricing
View Details
Recombinant TPX2 Antibody
RC-5953-01 50 μL

Recombinant TPX2 Antibody

Sign In for Pricing
View Details