Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N4BP3 Peptide - N-terminal region

N4BP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LZTS4

UniProt

O15049

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with N4BP3 Rabbit Polyclonal Antibody (orb587556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055926

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25B pSer187 Rabbit Polyclonal Antibody
AP12583PU-N 400 µL

CDC25B pSer187 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha Actinin Rabbit Polyclonal Antibody
ER1803-60 100 µL

alpha Actinin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Hydroxyethyl Oleate
TRC-H545210-2.5G 2.5 g

2-Hydroxyethyl Oleate

Sign In for Pricing
View Details
BCL2A1 Recombinant Rabbit Monoclonal Antibody [SC05-42]
ET1610-20 100 µL

BCL2A1 Recombinant Rabbit Monoclonal Antibody [SC05-42]

Sign In for Pricing
View Details
FKBP5 Antibody
KC-12196-01 50 μL

FKBP5 Antibody

Sign In for Pricing
View Details
FKBP5 Antibody
KC-12196-02 100 µL

FKBP5 Antibody

Sign In for Pricing
View Details