Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF6 Peptide - C-terminal region

NBPF6 Peptide - C-terminal region

Product Specifications

UniProt

E9PDL3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF6 Rabbit Polyclonal Antibody (orb587557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137459

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STLYSFEDKQVSLALVDKIKKDQEEIEDQSPPCPRLSQELPEVKEQEVPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SST CRISPR All-in-one AAV vector set (with saCas9)(Human)
45553151 3x 1.0 µg DNA

SST CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
VEGF-A
101-MBi60 50 µg

VEGF-A

Sign In for Pricing
View Details
Tert-Butyl 4- (4-nitroanilino) tetrahydro-1 (2H) -pyridinecarboxylate
sc-331822 500 mg

Tert-Butyl 4- (4-nitroanilino) tetrahydro-1 (2H) -pyridinecarboxylate

Sign In for Pricing
View Details
Panobinostat (LBH589) (HDAC inhibitor)
SC0294-10mM 10 mM x 0.2 mL

Panobinostat (LBH589) (HDAC inhibitor)

Sign In for Pricing
View Details
MRX78 Protein Vector (Human) (pPM-C-HA)
PV101568 500 ng

MRX78 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal ACAD8 Antibody
NBP1-32224 0.1 mL

Rabbit Polyclonal ACAD8 Antibody

Sign In for Pricing
View Details