NBPF7 Peptide - middle region
NBPF7 Peptide - middle region
Product Specifications
UniProt
P0C2Y1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NBPF7 Rabbit Polyclonal Antibody (orb587559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001041445
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELDKVQESPAPREEQKAEEKEVPEDSLEECAITYSNSHGPSDS NPPHKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
4043656 1 Each
Microscope slides-Paramecium Caudatum Differtial Staining QQ24
Sign In for Pricing
View Details 
18478141 1x 10^6 Cells / 1.0 mL
DNMT1 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
48045121 3x 1.0µg DNA
TRNAG20 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details MBS9944015-01 48 Well
Horse Prolactin-Releasing Peptide (PRLH) ELISA Kit
Sign In for Pricing
View Details